Refludan

Active Ingredient(s): Lepirudin
FDA Approved: * March 6, 1998
Pharm Company: * BERLEX
Category: Blood Thinner (Anticoagulant)

Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin[1] derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution ... [wikipedia]

* May have multiple approval dates, manufacturers, or labelers.

Dosage List

Refludan 50 mg/ml Intravenous Powder

NDC: 50419-150

Labeler:

Bayer Healthcare Pharmaceuticals Inc.